Inhibin, Beta C (INHBC) Mouse anti-Human Monoclonal (aa82-113) (betaC clone 1) Antibody
Inhibin, Beta C (INHBC) Mouse anti-Human Monoclonal (aa82-113) (betaC clone 1) Antibody WB, ELISA, IHC-P LOM-C58121-50
| Catalog ID: | LOM-C58121-50 |
|---|---|
| Target / Antigen: | Inhibin, Beta C (INHBC) Mouse anti-Human Monoclonal (aa82-113) (betaC clone 1) Antibody |
| Synonyms: | INHBC |
| Family / Subfamily: | TGF beta |
| Antigen Species: | Human |
| Antibody species / Host: | Mouse |
| Clonality (Clone name): | Monoclonal (clone: betaC clone 1) |
| Isotype | IgG1 |
| Antigen Modification / Antigen location: | aa82-113 |
| Antigen Type: | Specific for the BetaC-subunit of Activin (BetaC-activin), a member of the transforming growth factor beta (TGF-beta) superfamily and one of a group of proteins which regulate growth and differentiation in a range of cells and tissues, via both autoc ... |
| Immunogen: | Synthetic peptide / Synthetic peptide sequence VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC corresponding to amino acids 82-113 of mature human activin BetaC-subunit |
| Purification: | Affinity Chromatography |
| Presentation: | 0.09% sodium azide. |
| Recommended Storage: | Long term: -20В°C; Short term: -20В°C |
| Suggested uses: | Western Blot (WB) (1:5000), ELISA, Immunohistochemistry on paraffin slides (IHC-P) (Optimal dilution to be determined by the researcher) |
| Size: | 50 Вµg |
| Price: | €330 /ВЈ281 |
Write Your Own Review